LabDAO and its partners are developing an open-source network of computational tools and labs that give researchers the ability to focus on their strengths. We’re enabling scientists to research at industry pace.
A JupyterHub for all your collaborators to run tools for small-molecule docking, RNA-Seq analysis, protein design, etc.
One petabyte of cloud storage and distributed compute infrastructure.
Over 3000 contract labs for wet-lab experiments.
Small Molecule Blind docking
Small Molecule Blind docking
Protein folding
Histology preprocessing
Have a tool or an idea? Come build the next great idea with community and resources.
Want to get involved, but not sure how? Send us a message, and we can find a place together.
{
"input": [
{
"name": "gp47_tail",
"sequence": "MTANHLESPNCDWKNNRMAIVHMVNVTPLRMMEEPRAAVEAAFEGIMEPAVVGDMVEYWNKMISTCCNYYQMGSSRSHLEEKAQMVDRFWFCPCIYYASGKWRNMFLNILHVWGHHHYPRN DLKPCSYLSCKLPDLRIFFNHMQTCCHFVTLLFLTEWPTYMIYNSVDLCPMTIPRRNTCRTMTEVSSWCEPAIPEWWQATVKGGWMSTHTKFCWYPVLDPHHEYAESKMDTYGQCKKGGMV. RCYKHKQQVWGNNHNESKAPCDDQPTYLCPPGEVYKGDHISKREAENMTNAWLGEDTHNFMEIMHCTAKMASTHFGSTTIYWAWGGHVRPAATWRVYPMIQEGSHCQC", "parameters": {
"max_template_date": "2022-01-01",
"mode": "monomer_single",
"weights_download_url": "https://storage.googleapis.com/alphafold/alphafold_params_2021-10-27.tar",
"db": "full",
"is_prokaryote": 0
}
}
]
}