Accelerate

Your Research

Perform state-of-the-art life sciences research with a dedicated network of tools and labs

access tools and labs

LabDAO and its partners are developing an open-source network of computational tools and labs that give researchers the ability to focus on their strengths. We’re enabling scientists to research at industry pace.

with just a laptop you can access:

Notebooks

A JupyterHub for all your collaborators to run tools for small-molecule docking, RNA-Seq analysis, protein design, etc.

Compute Infrastructure

One petabyte of cloud storage and distributed compute infrastructure.

Wet-Lab Access

Over 3000 contract labs for wet-lab experiments.

Decentralized Infrastructure

Decentralized Infrastructure

Decentralized Infrastructure

Your Turn

Want to get involved, but not sure how? Send us a message, and we can find a place together.

Lets write the next chapter of Open Science together.

join community
create a project

{
  "input": [    
       {      
       "name": "gp47_tail",      
       "sequence":    "MTANHLESPNCDWKNNRMAIVHMVNVTPLRMMEEPRAAVEAAFEGIMEPAVVGDMVEYWNKMISTCCNYYQMGSSRSHLEEKAQMVDRFWFCPCIYYASGKWRNMFLNILHVWGHHHYPRN     DLKPCSYLSCKLPDLRIFFNHMQTCCHFVTLLFLTEWPTYMIYNSVDLCPMTIPRRNTCRTMTEVSSWCEPAIPEWWQATVKGGWMSTHTKFCWYPVLDPHHEYAESKMDTYGQCKKGGMV.   RCYKHKQQVWGNNHNESKAPCDDQPTYLCPPGEVYKGDHISKREAENMTNAWLGEDTHNFMEIMHCTAKMASTHFGSTTIYWAWGGHVRPAATWRVYPMIQEGSHCQC",             "parameters": {        
          "max_template_date": "2022-01-01",
         "mode": "monomer_single",
         "weights_download_url": "https://storage.googleapis.com/alphafold/alphafold_params_2021-10-27.tar",        
          "db": "full",        
          "is_prokaryote": 0      
        }    
      }  
    ]
}

Grab a coffee with us.

thanks for reaching out! a member of our team will be in touch 🙂
Oops! something just went wrong. mind trying one more time?