LabDAO is an online life science research collective. We provide and use open tools and infrastructure for computational life science research.
Access open sourced computational biology tools
Organically create and exchange data artefacts that enable tracking of how your scientific insight was generated
Reproduce experiments using the same tools, pipeline and data
We onboard computational and laboratory applications required for high-impact life science research. By using an open-source peer-to-peer exchange protocol, members can collaborate globally without intermediaries.
Our community consists of students, researchers, and engineers across the computational and pre-clinical life sciences. Join the community, learn from peers and form new ideas together.
Have a project you are working on? Launch a project or apply to join an existing one. Our community can help you with questions ranging from grant opportunities, to cloud computing, to digital entity formation.
Build highly reproducible container workflows on top of a decentralised compute network. LabDAO's Plex is a simple client for distributed computation.
Build once, run anywhere: Plex uses open source distributed compute and storage to run containers on a public network.
Ownernship tracking built-in: Every compute event on Plex generates an on-chain token that grants the holder ownership rights over the newly generated data.
Reproducible by default: Every file processed by Plex has a deterministic address based on its content. Keep track of your files and always share the right results with other scientists.
We onboard computational and laboratory applications required for high-impact life science research. By using an open-source peer-to-peer exchange protocol, members can collaborate globally without intermediaries.
Our community consists of students, researchers, and engineers across the computational and pre-clinical life sciences. Join the community, learn from peers and form new ideas together.
Have a project you are working on? Launch a project or apply to join an existing one. Our community can help you with questions ranging from grant opportunities, to cloud computing, to digital entity formation.
We’re a group of scientists, operators, and engineers who’ve experienced the limits of academia first hand.
If you’re interested in building a scientific organization for the 21st century, get in touch.
{
"input": [
{
"name": "gp47_tail",
"sequence": "MTANHLESPNCDWKNNRMAIVHMVNVTPLRMMEEPRAAVEAAFEGIMEPAVVGDMVEYWNKMISTCCNYYQMGSSRSHLEEKAQMVDRFWFCPCIYYASGKWRNMFLNILHVWGHHHYPRN DLKPCSYLSCKLPDLRIFFNHMQTCCHFVTLLFLTEWPTYMIYNSVDLCPMTIPRRNTCRTMTEVSSWCEPAIPEWWQATVKGGWMSTHTKFCWYPVLDPHHEYAESKMDTYGQCKKGGMV. RCYKHKQQVWGNNHNESKAPCDDQPTYLCPPGEVYKGDHISKREAENMTNAWLGEDTHNFMEIMHCTAKMASTHFGSTTIYWAWGGHVRPAATWRVYPMIQEGSHCQC", "parameters": {
"max_template_date": "2022-01-01",
"mode": "monomer_single",
"weights_download_url": "https://storage.googleapis.com/alphafold/alphafold_params_2021-10-27.tar",
"db": "full",
"is_prokaryote": 0
}
}
]
}