Research,

Reimagined

Updating the standard for open and reproducible computational biology

LabDAO is an online life science research collective. We provide and use open tools and infrastructure for computational life science research.

The latest comp bio tools

Access open sourced computational biology tools

Own your results

Organically create and exchange data artefacts that enable tracking of how your scientific insight was generated

Reproducibility built-in

Reproduce experiments using the same tools, pipeline and data

Open Tools Accelerate Progress

Open Tools Accelerate Progress

Open Tools Accelerate Progress

Open Tools Accelerate Progress

Open Tools Accelerate Progress

tools

We onboard computational and laboratory applications required for high-impact life science research. By using an open-source peer-to-peer exchange protocol, members can collaborate globally without intermediaries.

explore tools
read the docs
community

Our community consists of students, researchers, and engineers across the computational and pre-clinical life sciences. Join the community, learn from peers and form new ideas together.

apply to join
find talent
projects

Have a project you are working on? Launch a project or apply to join an existing one. Our community can help you with questions ranging from grant opportunities, to cloud computing, to digital entity formation.

explore projects
create a project

Access comp bio tools

Build highly reproducible container workflows on top of a decentralised compute network. LabDAO's Plex is a simple client for distributed computation.

  • Build once, run anywhere: Plex uses open source distributed compute and storage to run containers on a public network.

  • Ownernship tracking built-in: Every compute event on Plex generates an on-chain token that grants the holder ownership rights over the newly generated data.

  • Reproducible by default: Every file processed by Plex has a deterministic address based on its content. Keep track of your files and always share the right results with other scientists.

Join the Community

Find collaborators and make new friends—our community welcomes everyone. Meet scientists, founders, software engineers, and biotech practitioners.

tools

We onboard computational and laboratory applications required for high-impact life science research. By using an open-source peer-to-peer exchange protocol, members can collaborate globally without intermediaries.

explore tools
read the docs
community

Our community consists of students, researchers, and engineers across the computational and pre-clinical life sciences. Join the community, learn from peers and form new ideas together.

apply to join
find talent
projects

Have a project you are working on? Launch a project or apply to join an existing one. Our community can help you with questions ranging from grant opportunities, to cloud computing, to digital entity formation.

explore projects
create a project
stewards

We’re a group of scientists, operators, and engineers who’ve experienced the limits of academia first hand.

interested in joining our team?

If you’re interested in building a scientific organization for the 21st century, get in touch.

Grab a coffee with us.

join community
create a project

{
  "input": [    
       {      
       "name": "gp47_tail",      
       "sequence":    "MTANHLESPNCDWKNNRMAIVHMVNVTPLRMMEEPRAAVEAAFEGIMEPAVVGDMVEYWNKMISTCCNYYQMGSSRSHLEEKAQMVDRFWFCPCIYYASGKWRNMFLNILHVWGHHHYPRN     DLKPCSYLSCKLPDLRIFFNHMQTCCHFVTLLFLTEWPTYMIYNSVDLCPMTIPRRNTCRTMTEVSSWCEPAIPEWWQATVKGGWMSTHTKFCWYPVLDPHHEYAESKMDTYGQCKKGGMV.   RCYKHKQQVWGNNHNESKAPCDDQPTYLCPPGEVYKGDHISKREAENMTNAWLGEDTHNFMEIMHCTAKMASTHFGSTTIYWAWGGHVRPAATWRVYPMIQEGSHCQC",             "parameters": {        
          "max_template_date": "2022-01-01",
         "mode": "monomer_single",
         "weights_download_url": "https://storage.googleapis.com/alphafold/alphafold_params_2021-10-27.tar",        
          "db": "full",        
          "is_prokaryote": 0      
        }    
      }  
    ]
}

Want to learn more? Get in touch

thanks for reaching out! a member of our team will be in touch 🙂
Oops! something just went wrong. mind trying one more time?