Research,

Reimagined

Join the first open research organization built for computational life sciences

LabDAO is a new kind of research organization designed to unlock progress in computational life sciences.

Whether you’re an independent researcher or university affiliated, we provide the community and tools you need to access funding, find collaborators, and perform research.

We’re building the community-owned ARPA for the internet age.

Research your ideas today

Start leading a research project now, regardless of age or career stage. There are no gatekeepers. You don’t need to wait until you win a big grant or start your own lab.

Own your IP

Easily start a biotech or license your technology. No complex terms or lengthy negotiations with a tech transfer office.

Choose how you create impact

Publish your findings, launch a startup or create an open source tool. Share your research where and when it makes sense. No more publish or perish.

Open Tools Accelerate Progress

Open Tools Accelerate Progress

Open Tools Accelerate Progress

Open Tools Accelerate Progress

Open Tools Accelerate Progress

tools

We onboard computational and laboratory applications required for high-impact life science research. By using an open-source peer-to-peer exchange protocol, members can collaborate globally without intermediaries.

explore tools
read the docs
community

Our community consists of students, researchers, and engineers across the computational and pre-clinical life sciences. Join the community, learn from peers and form new ideas together.

apply to join
find talent
projects

Have a project you are working on? Launch a project or apply to join an existing one. Our community can help you with questions ranging from grant opportunities, to cloud computing, to digital entity formation.

explore projects
create a project

Start a Project

Kick off a project in less than 5 minutes with a short description of your research goal. You can then recruit collaborators, apply for grants, and manage grant funding.

If you don’t have an idea you want to pursue right now, you can still contribute to existing projects by joining our community.

Join our Community

Find collaborators, and make new friends. Join over 1000 energetic early-career scientists from universities like Stanford, MIT, University of Cambridge, and ETH Zurich.

Our community is composed of more than scientists. Meet software engineers, machine learning specialists, biotech practitioners, and legal experts.

Access tools and labs

Perform your research with our network of tools and labs. With just a laptop, you can access:

  • One petabyte of cloud storage and distributed compute infrastructure

  • Over 3000 contract labs for wet-lab experiments

  • A JupyterHub with pre-loaded environments to run tools for small-molecule docking, RNA-Seq analysis, protein design, etc.

tools

We onboard computational and laboratory applications required for high-impact life science research. By using an open-source peer-to-peer exchange protocol, members can collaborate globally without intermediaries.

explore tools
read the docs
community

Our community consists of students, researchers, and engineers across the computational and pre-clinical life sciences. Join the community, learn from peers and form new ideas together.

apply to join
find talent
projects

Have a project you are working on? Launch a project or apply to join an existing one. Our community can help you with questions ranging from grant opportunities, to cloud computing, to digital entity formation.

explore projects
create a project
stewards

We’re a group of scientists, operators, and engineers who’ve experienced the limits of academia first hand.

interested in joining our team?

If you’re interested in building a scientific organization for the 21st century, get in touch.

Grab a coffee with us.

join community
create a project

{
  "input": [    
       {      
       "name": "gp47_tail",      
       "sequence":    "MTANHLESPNCDWKNNRMAIVHMVNVTPLRMMEEPRAAVEAAFEGIMEPAVVGDMVEYWNKMISTCCNYYQMGSSRSHLEEKAQMVDRFWFCPCIYYASGKWRNMFLNILHVWGHHHYPRN     DLKPCSYLSCKLPDLRIFFNHMQTCCHFVTLLFLTEWPTYMIYNSVDLCPMTIPRRNTCRTMTEVSSWCEPAIPEWWQATVKGGWMSTHTKFCWYPVLDPHHEYAESKMDTYGQCKKGGMV.   RCYKHKQQVWGNNHNESKAPCDDQPTYLCPPGEVYKGDHISKREAENMTNAWLGEDTHNFMEIMHCTAKMASTHFGSTTIYWAWGGHVRPAATWRVYPMIQEGSHCQC",             "parameters": {        
          "max_template_date": "2022-01-01",
         "mode": "monomer_single",
         "weights_download_url": "https://storage.googleapis.com/alphafold/alphafold_params_2021-10-27.tar",        
          "db": "full",        
          "is_prokaryote": 0      
        }    
      }  
    ]
}

Grab a coffee with us.

thanks for reaching out! a member of our team will be in touch 🙂
Oops! something just went wrong. mind trying one more time?